Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens trafficking protein particle complex 2 like (TRAPPC2L), transcript variant 2 (NM_016209). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9UL33 |
| Entry Name | TPC2L_HUMAN |
| Gene Names | TRAPPC2L HSPC126 |
| Alternative Gene Names | |
| Alternative Protein Names | Trafficking protein particle complex subunit 2-like protein |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 140 |
| Molecular Weight(Da) | 16146 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC |
Background
| Function | FUNCTION: Plays a role in vesicular transport from endoplasmic reticulum to Golgi. {ECO:0000269|PubMed:19416478, ECO:0000269|PubMed:30120216}. |
| Pathway | |
| Protein Families | TRAPP small subunits family, Sedlin subfamily |
| Tissue Specificity | Expressed in testis, liver, bladder, lung, spleen and brain, several cell lines and primary chondrocytes cell line. {ECO:0000269|PubMed:19416478}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |